SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007211 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007211
Domain Number 1 Region: 60-185
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-16
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 404-445
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000123
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007211   Gene: ENSTBEG00000008325   Transcript: ENSTBET00000008318
Sequence length 452
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_6058:63352:76548:1 gene:ENSTBEG00000008325 transcript:ENSTBET00000008318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARETFPFTSSTLRSLRLQREWLEWEDRRRAAAQQCRNQRHPSSPRARLTRPPRCCRDPA
VHNALFSGDLPQVQALFQDEETANMIVETVSNQLAWSAEQGFWVLTPKTKQTAPLTIAAA
RGYIDCARHLILQGAELDARVGGQAALHEACARAQPDCVRLLLTFGAKANVLSQEGMTPL
HLCTAPESLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLKYCA
NFPRALEVLLNAYPCVPSCDTWVDSVLPELWQEHEAFYSSALCMVNQPRRLQHLARLPVR
SQLGSRCQAATRLPLPPLLRDYLLLRVEGRIQ
Download sequence
Identical sequences ENSTBEP00000007211 ENSTBEP00000007211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]