SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007218 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007218
Domain Number 1 Region: 105-121,238-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-25
Family FAD-linked reductases, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007218   Gene: ENSTBEG00000008327   Transcript: ENSTBET00000008327
Sequence length 361
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5234:134153:146818:1 gene:ENSTBEG00000008327 transcript:ENSTBET00000008327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGAWDHICKMRYRAFRRMQVWDACSEALIMFDKDHLDDMGYIVENDVIMHALTKQLEAVA
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGAIGHNSGVRQAAGI
QNVSWNYDQSAVVATLHLSEATENNVAWQRFLPSLSDTLSSLVWSTSHEHAAELVSMGEE
EFVDAINSAFWSDVNHTDFIDSAGTMLRYAVALLKPTKISARQLPPSVASVDAKSRMLFP
LGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDVSSLAHHLSTAAFNGKDLGSMS
HLTGYETDRQRHNTVLLAATDFLKRLYSTSATPLVLLRTWGLQATNAVSPLKEQIMAFAS
K
Download sequence
Identical sequences ENSTBEP00000007218 ENSTBEP00000007218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]