SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007268 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007268
Domain Number 1 Region: 89-182
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 2.75e-31
Family Troponin I 0.00000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007268   Gene: ENSTBEG00000008390   Transcript: ENSTBET00000008383
Sequence length 201
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2150:361:5894:-1 gene:ENSTBEG00000008390 transcript:ENSTBET00000008383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPRPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDLRQLHARVDKVDEERYDVEPKVTKNITEIADLT
QKIFDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDTEKEIREVG
DWRKNIDALSGMEGRKKKFEG
Download sequence
Identical sequences ENSTBEP00000007268 ENSTBEP00000007268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]