SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007272 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007272
Domain Number 1 Region: 297-604
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.86e-93
Family PDEase 0.000000327
Further Details:      
 
Domain Number 2 Region: 167-280
Classification Level Classification E-value
Superfamily GAF domain-like 3.49e-33
Family GAF domain 0.00019
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily GAF domain-like 2.7e-22
Family GAF domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007272   Gene: ENSTBEG00000008369   Transcript: ENSTBET00000008388
Sequence length 624
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5420:49182:412050:-1 gene:ENSTBEG00000008369 transcript:ENSTBET00000008388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQMYLP
FCGIAISNAQLFAASRKEYERSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTGL
PVNISDAYQDPRFDAEADHISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQ
RLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKVAHILVSD
IDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWR
HAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTEF
FELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQASELVTSEFFEQGDRERS
ELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPILDSVAANRSKWEE
HQKLSISAASPSPTSLLVAKENRN
Download sequence
Identical sequences ENSTBEP00000007272 ENSTBEP00000007272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]