SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007431 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007431
Domain Number 1 Region: 22-168
Classification Level Classification E-value
Superfamily Lysozyme-like 1.14e-16
Family G-type lysozyme 0.0000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007431   Gene: ENSTBEG00000008586   Transcript: ENSTBET00000008575
Sequence length 168
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5041:95394:102638:-1 gene:ENSTBEG00000008586 transcript:ENSTBET00000008575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLLLGLLALTGSSESSNWGCYGNIRTVDTPGASCMIGRRHGLNYCGVRASERLAEI
DMPYLLRFQPVIRTVGQKYCMDPAVIAGVLSRESPGGNVLVNVGDGIGAVQDSSFYAPTS
WITESQVSQKTEVLTSKIKEIQRRFPTWTPDQCLRGGLCAYDGGVGYV
Download sequence
Identical sequences ENSTBEP00000007431 ENSTBEP00000007431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]