SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007526 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007526
Domain Number 1 Region: 104-258
Classification Level Classification E-value
Superfamily Caspase-like 1.38e-47
Family Caspase catalytic domain 0.00000353
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000165
Family Caspase recruitment domain, CARD 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007526   Gene: ENSTBEG00000008692   Transcript: ENSTBET00000008687
Sequence length 371
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5434:1968:95173:-1 gene:ENSTBEG00000008692 transcript:ENSTBET00000008687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNHRKNPFKFLELIGKEFATGILSDLVENNVLKLKEDEKKKFYEAKPEDKPWVVVDTVRD
KRHEAGQKFIQTFFNIDKVSNKTXXXXXXXXXXXSEEYTGKLKLCREKFLELRTKEAGKI
YEIKEKGDRTRLALIICNTEFDHLPRRNGSNHDITGMKGLLEDLGYSVDVEENLTARAMK
LVLRKFAARPEHKTSDSSFLVCMSHGILEGICGINHSDENPDVLPYDPIFQILNNRNCPH
LKDKPKVIIIQACRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQRSFEEPGIISSIPTQERQ
TITTNVLTGYD
Download sequence
Identical sequences ENSTBEP00000007526 ENSTBEP00000007526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]