SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007805 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007805
Domain Number 1 Region: 52-265,376-430
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.91e-46
Family FAD-linked reductases, N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 676-764
Classification Level Classification E-value
Superfamily Folate-binding domain 3.45e-27
Family Aminomethyltransferase folate-binding domain 0.00033
Further Details:      
 
Domain Number 3 Region: 766-852
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.96e-21
Family Aminomethyltransferase beta-barrel domain 0.00061
Further Details:      
 
Domain Number 4 Region: 332-375
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000365
Family L-aminoacid/polyamine oxidase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007805   Gene: ENSTBEG00000008994   Transcript: ENSTBET00000009006
Sequence length 863
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2318:11721:122886:-1 gene:ENSTBEG00000008994 transcript:ENSTBET00000009006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCRGARRLRTLPLWSSPPRGSSGGPRSLCSQDGGQKPPLPAETQWKDRAETVIIGGGCV
GVSLAYHLARAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYERLE
EETGQVVGFHQPGSIRIATTPVRVDEFKYQMTRTGWHATEQYIIEPEKIQEMFPLLNMDK
ILAGLYNPGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLKPRLDGTWDVDTPQGSVR
ANRIVNAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGKELFESDLDRIMEHVKAAMEMVPVLK
KADIINIVNGPITYSPDILPMVGPHQGVRNYWVAIGFGXXXXXXGGVGKYLSDWILGEPH
DLILDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYKTLRSKCS
MGFHAGWEQPHWFYKPGQDTQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXELGWELYHRQEDSATLYDAIMNAGQEEGIDNFGTYAMNALRLEKA
FRAWGSEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKAKGLKRRLVCLTLATDDVD
PEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPTELSTVGQQVEVELLGNNYPAVII
QEPLVLTEPTRNRLQRKGGTDKI
Download sequence
Identical sequences ENSTBEP00000007805 ENSTBEP00000007805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]