SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008057 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008057
Domain Number 1 Region: 543-588
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 121-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 61-109
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000497
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000008057
Domain Number - Region: 497-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000829
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008057   Gene: ENSTBEG00000009304   Transcript: ENSTBET00000009305
Sequence length 589
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3687:456949:544949:-1 gene:ENSTBEG00000009304 transcript:ENSTBET00000009305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLRTGTWTPAELFFLSAALGCFSLPGSRGERPLSFGSNAVNNSLIQSRQKRSVDVTPMP
IDCELSSWSSWTTCDPCQKKRYRHAYLLRPSQFHGEPCSFSDKEVEDCVTSRPCRTQVRC
EGFMCAQTGRCVNRRLLCNGDNDCGDQSDEANCRKIYQKCHQEVDQYWAIGNLASGINLF
TNNLEGPVLDHRYYAGGCSSHYILNTRFRKPYNVESYTPQXXXXXEFARTEYESYSDFER
TVMEKSTSEFSFGFGLKVPGIFEFGISHASDQGKHYVSRIKRFSHTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXYSLSNIHACAQAGFNIGAAIKVVYAKLGVSASQCEGILKEINXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEPLYELVTATDFAYS
STVKENMKRALEEFQKETSSCHCAPCQGNGVPVLKESRCDCICPAGFKGPACEVTHRKSV
PTDGRWNCWSNWSSCSGGHKTRQRQCNNPPPQNGGNPCSGPASETLKCF
Download sequence
Identical sequences ENSTBEP00000008057 ENSTBEP00000008057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]