SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008166 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008166
Domain Number 1 Region: 56-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000112
Family FAD-linked reductases, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008166   Gene: ENSTBEG00000009440   Transcript: ENSTBET00000009435
Sequence length 494
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3041:3183:13936:1 gene:ENSTBEG00000009440 transcript:ENSTBET00000009435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAGAASLHVALAALLAAGAAGGDPQPGKIXXXXXXXXXXXXXXXXQQHFGPRVQIDVYEK
GTVGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLGLRHRREVVGRSAIFGGEHFVL
EETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGE
SAFVNMTQRSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAAMPAFAGAMSLAGAQGSLW
SVEGGNKLVCSGLLKLTKANVIHATVTSVTLHSTEGKALYQVGYENEVGNGSDFYDIVVI
ATPLHRDNSSSNFTFEGFTPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPDPKLFPFANIL
TTDFPNFFCTLDNICPVNISANFRRKQPQEAAVWRVQSPKPLLRTQLKTLFRSYYSVQTA
EWQAHPLYGSRTTIPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDK
IDQKDLMHKVKTEL
Download sequence
Identical sequences ENSTBEP00000008166 ENSTBEP00000008166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]