SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008395 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008395
Domain Number 1 Region: 64-166
Classification Level Classification E-value
Superfamily PUA domain-like 3.98e-37
Family Atu2648/PH1033-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008395   Gene: ENSTBEG00000009682   Transcript: ENSTBET00000009698
Sequence length 208
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2331:189371:194850:-1 gene:ENSTBEG00000009682 transcript:ENSTBET00000009698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPRKRQAGAASPXXXXXXXXXKIENSGKRTENSTPLNFSFKWENPDSSRMMSEPGREK
GVVKFSIEDLRAQPKQTTCWDGVRNYQARNFLRAMKLEEEAFFYHSNCKEPGIAGLIXIV
KEAYPDHTQFEKNDPHYDPSSKKDNPKWSMVDVQLVRIKKRFRGVYIYKGQKKEGGAVKK
RILFSHKLSVLFLKEFDFILSLEEKEPS
Download sequence
Identical sequences ENSTBEP00000008395 ENSTBEP00000008395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]