SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008396 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008396
Domain Number 1 Region: 143-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.11e-124
Family Transglutaminase core 0.0000000103
Further Details:      
 
Domain Number 2 Region: 2-141
Classification Level Classification E-value
Superfamily E set domains 2.52e-39
Family Transglutaminase N-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 612-710
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.19e-28
Family Transglutaminase, two C-terminal domains 0.00024
Further Details:      
 
Domain Number 4 Region: 499-610
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.11e-26
Family Transglutaminase, two C-terminal domains 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008396   Gene: ENSTBEG00000009696   Transcript: ENSTBET00000009699
Sequence length 713
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1630:325884:356335:-1 gene:ENSTBEG00000009696 transcript:ENSTBET00000009699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEVAVTDFRCYWNNVRHHTEEISIDRLLVRRGQDFNIILYFRNRGFQLGLDNIVFVVETG
PLPDLAKGTRAMFSLQGRDGPSPWTALLETNGATSLEVRLCAPPMAAVGRYVLKIHVDSF
QGSTRAYQLGEFILFFNPWCPGDPVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCPWNYG
QFEEKIIDICLELLDKSLHFQIDPATDCALRGSPVYISRVVCAMINSNDDNGVLNGNWSE
NFMDGVNPAEWTGSVAILKQWHTTGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVVTNFDS
GHDTDGNLIIDEYYDNTGRILENKKKDTVWNFHVWNECWMARTDLPPGFGGWQVLDATPQ
ETSNGLYCCGPASVRAIKEGEVDLNYDTPFAFSMVNADCMSWLVYRGTEQRLHRDTSTVG
NMISTKSIQGDERDDITENYKYEEGTPQERQVFLKALQKLNAGKSLGPHRADSQAGPVSL
SQGSPRSSGASSLRTADIQISLKFRLLDPPYMGQDINFVLLALNMSSQFKDLKVNLSAQS
LLHDGSPLPPFWQDVVFITLTSEEAKTHRCTIPYSQYSQYLSTDKLIRISALGEEKNTPG
KILVDKIITLAYPSIMINVLGAAVVNQPLSIQVIFSNPLEEQVEDCVLTMEGSGLFKKQL
RVLIGVLKPHHKASITLKTVPFKSGQRQIQANLRSNKFKDIKGYRNIYVDFGL
Download sequence
Identical sequences ENSTBEP00000008396 ENSTBEP00000008396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]