SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008415 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008415
Domain Number 1 Region: 278-417
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.57e-49
Family Calpain large subunit, middle domain (domain III) 0.00000445
Further Details:      
 
Domain Number 2 Region: 109-274
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.34e-43
Family Calpain large subunit, catalytic domain (domain II) 0.000000824
Further Details:      
 
Domain Number 3 Region: 441-589
Classification Level Classification E-value
Superfamily EF-hand 3.76e-20
Family Penta-EF-hand proteins 0.00045
Further Details:      
 
Domain Number 4 Region: 1-63
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.42e-20
Family Calpain large subunit, catalytic domain (domain II) 0.0000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008415   Gene: ENSTBEG00000009706   Transcript: ENSTBET00000009720
Sequence length 618
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2474:88063:167009:1 gene:ENSTBEG00000009706 transcript:ENSTBET00000009720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNDKALARVVPQDQSFGPGYAGIF
HFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNGSYEALKGGS
AIEAMEDFTGGVAETFLTKEAPENFYELLEKALKRGSLLGCSIDVRNAAETEARTPFGLI
KGHAYTVTGVDQVNFRGQKVELIRVRNPWGQVEWNGSWSDXXXXXXXXXXXXXXXXXXXX
XXXXXXXMAFKDFKAQFDKVEICNLTPDALDDGALHKWEVTIHQGSWVRGSTAGGCRNFL
DTFWTNPQIKLSLTEKDEGQEECTFLVALMQKDRRKLKRFGANVLTIGYAIYQCPDGGER
LDRDFFRFHASQARSKTFINLREVSGRFRLPPGEYVLIPSTFEPHQEADFCLRISEKRAV
TQDMDGSVDIDLPEPTKPSPPSEETEEERQFRALFERIAGEDMEVTAEELKYVLNAVLQK
KKDIKFKKLSLSSCKNIISLMDTSGNGKLELDEFKVFWTKLKEWIXXXXXXXXXXXXXXX
XXXXXXXXXXXXFQLGSHLLQLVVLRYADEGLQLDFDDFLCCLVRLENASXXXXXXXXXX
XXXXXXXXXXFINLTMNI
Download sequence
Identical sequences ENSTBEP00000008415 ENSTBEP00000008415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]