SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008528 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008528
Domain Number 1 Region: 282-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.56e-70
Family Transglutaminase core 0.000000667
Further Details:      
 
Domain Number 2 Region: 492-603
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.5e-27
Family Transglutaminase, two C-terminal domains 0.00027
Further Details:      
 
Domain Number 3 Region: 143-236
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.17e-25
Family Transglutaminase core 0.0000905
Further Details:      
 
Domain Number 4 Region: 606-701
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.19e-23
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008528   Gene: ENSTBEG00000009836   Transcript: ENSTBET00000009845
Sequence length 704
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5512:610124:653661:1 gene:ENSTBEG00000009836 transcript:ENSTBET00000009845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXDDVFLASEEERQEYVLNDSGIIFRGVEKRIRAQGWNYG
QFEEDILNICLSILDRSPSHQDSPATDVSRRHDPIYVTRIISAMVNSNDRGVVQQWQGKY
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRCLGIATRVVSNFNSAH
DTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARKDLGPSYNGWQVLDATPQEE
SEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYVTWLWNEDESRERVYSDTKKIGR
CISTKAVGSDSRVDITSLYKYPEGSRKERQVYSKAVKKLFSVEASGRRTRLRRAGGRGLW
RDDLLEPATKPSITGKFKVLEPPMLGQDLKLALCLANLTSRAQRIRVNLSGATILYTRKP
VAEILHESHAVRLGPQEEKKIPITISYSQYKEDLTEDKKILLAAMCLVTKGEKLLVEKDI
TLEDFIIIKVLGPAVVGVVVAVEVTVVNPLLEKVKDCVLIVEGSGLLRGQLSLDVPSLEP
QERASVQFDITPSKSGPRQLQVDLVSSHFPDIKGFVVIHVATAK
Download sequence
Identical sequences ENSTBEP00000008528 ENSTBEP00000008528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]