SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008547 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008547
Domain Number 1 Region: 334-449
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.57e-42
Family Transglutaminase core 0.0000324
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily E set domains 4.2e-42
Family Transglutaminase N-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 479-598
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.41e-24
Family Transglutaminase, two C-terminal domains 0.0018
Further Details:      
 
Domain Number 4 Region: 148-224
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000000000000392
Family Transglutaminase core 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008547   Gene: ENSTBEG00000009846   Transcript: ENSTBET00000009866
Sequence length 605
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1630:375846:403025:-1 gene:ENSTBEG00000009846 transcript:ENSTBET00000009866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQVAALELRSVDLQISRNNKEHHTQEMGRKRLITRRGQAFTFQMFFSRPFQSQTDHIIF
MAETGPEPTELLGTRATFLLTQAQSRNGWSVSEFTAASNSLQVTLFTPANAVIGYYTLKM
EITQGQGPSATYPVGTFILLFNPWSTEDDVYLPSEILLQEYIMKDYGFVYKGHEKFITSW
PWNFGQFEEDIIDICFEILNKSLYFLNNWSKDYSRRNDVVYVXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFHVWNECWMIRRDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGEVHLAYDTPFVFAEVNADEVIWLFEEGQAQEILAH
NTSSIGKEISTKMVGSDQRQDITSSYYPEXXPEEVVMKSRNVPRSSSFLDLLGSGSTEDR
PAQLQLHLIKVPEWGQDLLLMLHVRRVPDRVHPRGPIRLAVHFCAQALLHGGSAREPLWR
QTVHLSLDFGEETRWPLLLPYNSYRNRLTDEKLIRVSGIARVEETGKYMLVLKDISLEPP
HLSIE
Download sequence
Identical sequences ENSTBEP00000008547 ENSTBEP00000008547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]