SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008976 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008976
Domain Number 1 Region: 14-168
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000144
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008976   Gene: ENSTBEG00000010392   Transcript: ENSTBET00000010383
Sequence length 263
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_6075:689485:707695:-1 gene:ENSTBEG00000010392 transcript:ENSTBET00000010383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPGVTEVTIIEKAPAERHMISSWEQKNNCTMPEDMKNFYLMTNGFHMTWSVKLDHIIPL
GSMAINSISLTQLNQSSMYALPNAPTLEDLEDDIHEASEEQPEKPHFDSRSVLFELDSCN
GNGKVCLVYKSGKPASAQDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTS
YGISPQAKQWFSMYKPITYNTNLLAEETDCFVNKLDPSKVFKSKNKILIPKKKGPVQPVG
GQKGPPGPSTSKSSSGSGNPIRK
Download sequence
Identical sequences ENSTBEP00000008976 ENSTBEP00000008976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]