SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009134 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009134
Domain Number 1 Region: 747-831
Classification Level Classification E-value
Superfamily PWI domain 0.00000196
Family PWI domain 0.0028
Further Details:      
 
Domain Number 2 Region: 105-159
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000244
Family Canonical RBD 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009134   Gene: ENSTBEG00000010538   Transcript: ENSTBET00000010559
Sequence length 839
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1741:33740:88511:1 gene:ENSTBEG00000010538 transcript:ENSTBET00000010559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFPPQFDRHPMGILAFLGIPPQFGLSPPVPPGTPMIPVPMSIMAPAPTXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKCGLVLSWKRVQGASG
KLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKASNGNAR
PETVTNDDEEALDEETKRRDQMIKGAIEVLIREYSSELNAPSQESDSHPRKKKKEKKEDX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRERERE
REKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEE
RRREMXXXXXXXXXXXXXXXXXXXXXXXXXGSALQKRLRDREKEMEADERDRKREKEELE
EIRQRLLAEGHPDPDAELQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIIPHENSPDQQHAEEHRP
KIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNA
AKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIG
EEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK
Download sequence
Identical sequences ENSTBEP00000009134 ENSTBEP00000009134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]