SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009253 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009253
Domain Number 1 Region: 24-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.54e-37
Family Eukaryotic proteases 0.0000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009253   Gene: ENSTBEG00000010712   Transcript: ENSTBET00000010701
Sequence length 235
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_40:279076:284389:-1 gene:ENSTBEG00000010712 transcript:ENSTBET00000010701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFIFYLSVLAGTIFFVHSAVQKEDHAPYLVYLKSHFNPCVGVLIKINWVLAPAHCYLPN
LKLMLGNFKSRVRDGTEQTINPIQIIRYWNYSDSAPQDDIMLIKLAKPATLNVKVQLLPL
ATSSPRPGTMCMLSGLDWSQENNGRHPDLRQNLEAPVMSDKDCQKTEQGKSHRNSLCVKF
VKVFSRIFGEVALATVICKNKLQGIEVGHFMGGDVGIYTNVYKYVSWIERTTKDK
Download sequence
Identical sequences ENSTBEP00000009253 ENSTBEP00000009253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]