SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009320 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009320
Domain Number 1 Region: 2-280
Classification Level Classification E-value
Superfamily HAD-like 9.47e-80
Family Pyrimidine 5'-nucleotidase (UMPH-1) 0.0000000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009320   Gene: ENSTBEG00000010782   Transcript: ENSTBET00000010779
Sequence length 291
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2836:57185:67926:-1 gene:ENSTBEG00000010782 transcript:ENSTBET00000010779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATVLMRQPGRVQEIVGALRRGGGDRLQVISDFDMTLSRFAYNGKRCPSSYNILDNSRI
ISEECQKELTALLHHYYPIEIDPHRTIKEKLPHMVEWWTKAHSLLCQQKIQKFQIAQVVR
ESNAMLREGYKTFFNTLYQNNIPLFIFSAGIGDILEEIIRQMKVFYPNIHIVSNYMDFNE
DGFLQGFKGQLIHTYNKNSSVCENSSYFQQLQGKTNILLLGDSMGDLTMADGVPGVQNIL
KIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHILQGDQLEVQGS
Download sequence
Identical sequences ENSTBEP00000009320 ENSTBEP00000009320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]