SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009369 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009369
Domain Number 1 Region: 5-61
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.00000000000000292
Family D-ribulose-5-phosphate 3-epimerase 0.00057
Further Details:      
 
Domain Number 2 Region: 178-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.000000024
Family D-ribulose-5-phosphate 3-epimerase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009369   Gene: ENSTBEG00000010833   Transcript: ENSTBET00000010833
Sequence length 228
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_2968:222185:244769:1 gene:ENSTBEG00000010833 transcript:ENSTBET00000010833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECYRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGP
ETVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences ENSTBEP00000009369 ENSTBEP00000009369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]