SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009414 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009414
Domain Number 1 Region: 35-258
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.39e-60
Family Ankyrin repeat 0.0000472
Further Details:      
 
Domain Number 2 Region: 204-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.73e-16
Family Ankyrin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 447-491
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000157
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009414   Gene: ENSTBEG00000010869   Transcript: ENSTBET00000010886
Sequence length 509
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1541:88742:160025:-1 gene:ENSTBEG00000010869 transcript:ENSTBET00000010886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFTEAYSDTCSAVGFAAEGNVKIRKLLKGRSDVSDRMQHAAYHSVECLQMLIHADSSEN
YIKSKTFDGFCPLHLAASQGHWKIVQILLEAGEDPNVTTLENNTPLFLAVENGQINVVRL
LLRHGANVNGSHSMCGWNSLHQASFQGNAEIIKLLLKKGANKEYQDDFGITPLFVAAQYG
KLESLSMLISSGANVNCQASDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDNWQLP
IHAAAQMGHTKILDLLIPLTNRACDTGQDKVSPVYSAVFGGHEECLEMLLQKGYSPDAQT
CLIFGFSSPMCMAFQKGCEFFGIVNILLKYGAQLNELHLAYCLKYEKFSVFRHFLKKGCE
LTAWSHTSEFISYAVKAQAKYKEWLPYLLLSGFDPLTLLCSSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSIPSLTHLCRLEIRSSLKPEHLKSDSFICQLPL
PRSLHNYLLYAEVLRMNDVPELTALQDGE
Download sequence
Identical sequences ENSTBEP00000009414 ENSTBEP00000009414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]