SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009469 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009469
Domain Number 1 Region: 22-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.71e-48
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 374-421
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000222
Family SOCS box-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009469   Gene: ENSTBEG00000010962   Transcript: ENSTBET00000010950
Sequence length 426
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3560:639784:711146:1 gene:ENSTBEG00000010962 transcript:ENSTBET00000010950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDTTVPTTKSGAAKLVKKNFLEALKSNDFGKLKAILIQRQIDVDTVFEVEDENMVLASY
KQGYWLPSYKLKSSWATGLHLSVWFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANL
DCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLH
TAAHFGLPELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSKEHHLICRMLLD
YKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRP
AAQPELCYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNIKWRRAIPD
DDLERYWDFYHSLFTVCCNSPRTLMHLSRCAIRRALHNRCHRAIPSLSLPLSLKKYLLLE
PEGIIY
Download sequence
Identical sequences ENSTBEP00000009469 ENSTBEP00000009469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]