SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009677 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009677
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 3.01e-46
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009677   Gene: ENSTBEG00000011214   Transcript: ENSTBET00000011200
Sequence length 180
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2188:799:3707:1 gene:ENSTBEG00000011214 transcript:ENSTBET00000011200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGH
NKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVTVTISQDAGRYLC
DFTYYTSLYQTHGRSAFVHVPPLGKPYNADQLGRALRVIIEEMLSLLEQSEGNISYCHKH
Download sequence
Identical sequences ENSTBEP00000009677 ENSTBEP00000009677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]