SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009717 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009717
Domain Number 1 Region: 6-274
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.12e-79
Family Papain-like 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009717   Gene: ENSTBEG00000011246   Transcript: ENSTBET00000011244
Sequence length 276
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3283:25757:35820:-1 gene:ENSTBEG00000011246 transcript:ENSTBET00000011244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESLNRHRYLNSLFSKENSTAFYGINQFSYLFPEEFKAIYLRSKASKLPRYVAGGQTTFSS
ESLPLRFDWRDKHIVTPVRNQQTCGACWAFSVVSAVESACAMAGAPLRELSVQQVLDCAY
DDRGCGGGSTLSALSWLNKTQVKLVGESEYPFTARDGICRFFPASCPGVSIRGYLAYDFS
AQEDEMAKALMALGPLVAVVNAVSWQDYLGGVIQHHCSSGEANHAVLVTGFDKAGETPYW
VVRNSWGRSWGLDGYARVKMGSNICGIADSVSAVLV
Download sequence
Identical sequences ENSTBEP00000009717 ENSTBEP00000009717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]