SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009723 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000009723
Domain Number - Region: 87-113
Classification Level Classification E-value
Superfamily Lysozyme-like 0.000218
Family C-type lysozyme 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009723   Gene: ENSTBEG00000011255   Transcript: ENSTBET00000011250
Sequence length 214
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_2806:34451:62252:1 gene:ENSTBEG00000011255 transcript:ENSTBET00000011250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASALEGRFLVREHSGPISSSSVSAPLGLVSCLPSQRSALSQSGRSTSATHMEARSWAPG
RRLCPPRIMLLVLGSLLSCLLAASEAKVYSRCELARVLQDFGLDGYRGYSLADXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEAWRHNYQGKDLSDWVDGCDY
Download sequence
Identical sequences ENSTBEP00000009723 ENSTBEP00000009723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]