SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009891 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000009891
Domain Number - Region: 428-474
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0183
Family Glycerol-3-phosphate transporter 0.039
Further Details:      
 
Domain Number - Region: 498-538
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0745
Family Pentapeptide repeats 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009891   Gene: ENSTBEG00000011447   Transcript: ENSTBET00000011449
Sequence length 539
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5075:37163:44232:-1 gene:ENSTBEG00000011447 transcript:ENSTBET00000011449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDYPA
PADGYYRGEGAQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GARGGLSDGEGPPGGRGEAQRRKEREELAQQYEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLIVYLGMXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY
AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDV
Download sequence
Identical sequences ENSTBEP00000009891 ENSTBEP00000009891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]