SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009963 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009963
Domain Number 1 Region: 31-229
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-39
Family GDI-like N domain 0.0000000179
Further Details:      
 
Domain Number 2 Region: 354-392
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000129
Family GDI-like N domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009963   Gene: ENSTBEG00000011523   Transcript: ENSTBET00000011530
Sequence length 403
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4768:571302:596812:-1 gene:ENSTBEG00000011523 transcript:ENSTBET00000011530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESASITSLEDXXXXXXXXXXPPASMGRGRDWNVDLPKFLMANGQLVKMLLYTEVTRYLDF
KVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDSRTFEGID
PKKTSMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKS
PYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFISR
TYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences ENSTBEP00000009963 ENSTBEP00000009963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]