SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010127 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010127
Domain Number 1 Region: 442-614,643-699
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-30
Family YWTD domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 233-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000236
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000327
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 4 Region: 271-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 5 Region: 149-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000654
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 8 Region: 395-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 9 Region: 359-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000306
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 317-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 11 Region: 187-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 703-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010127   Gene: ENSTBEG00000011690   Transcript: ENSTBET00000011714
Sequence length 872
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3134:167802:206388:1 gene:ENSTBEG00000011690 transcript:ENSTBET00000011714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSARWVLWLLLALCWASPESGATGTGRKLKCEPSQFQCTNGRCITQLWKCDGDEDCAD
GSDEKNCVKKTCAESDFVCNNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRISEISC
GARSTLCIPVSWRCDGENDCDSGEDEENCGNITCSADEFTCSSGRCISRNFVCNGQDDCN
DGSDELDCAPPTCSAHEFQCSTSSCIPSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPA
SEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIR
DCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHVNECL
VNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCEC
SRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQ
KLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVAT
LDGTKRKFLFNSDLREPASIAVDPLSGXXXXXXWGEPAKIEKAGMNGFDRRPLVTVDIQW
PNGITLXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLKSLEFLAHPLALTIFEDRVYWID
GENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDLENGGCEYLCLP
APQINDHSPKYTCACPNGYNLEENGRTCHSTTTTVTYSETKDTNTTEISPTSGLVPGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTT
EEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences ENSTBEP00000010127 ENSTBEP00000010127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]