SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010667 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010667
Domain Number 1 Region: 89-240,385-468
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.44e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.064
Further Details:      
 
Domain Number 2 Region: 520-564
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000134
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 785-818
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000058
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000010667
Domain Number - Region: 819-847
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000146
Family LIM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010667   Gene: ENSTBEG00000012302   Transcript: ENSTBET00000012315
Sequence length 964
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_728:6688:76225:-1 gene:ENSTBEG00000012302 transcript:ENSTBET00000012315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKHETMNQAHVLFDRFVQATPRKGTLAFQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXCLIIGAGPCGLRTAIDLSLLGAKVVVVEKRDAF
SRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVNV
EFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGKL
AIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFVM
TAKKQSLLDKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINHY
GQPDVAMFDFTCMYASENAALVREQNGHPLLVALVGDSLLEPFWPMGTGVARGFLAAMDS
AWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNINVNFLRP
SQVRHLYDTGEAKDIHLEMESLANPRATPKLTRNESVARSSKLLGWCQRQTDGYAGVSVT
DLTMSWKSGLALCAIIHRYRPDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLDLNAEDKAMLIASTKSPISFLSKLGQTI
SRKRSPKDKKEKDLDGAGKRRKTSQSEEEEVPRGCRGERPTLVSTLTDRRMDIALGNQNK
VKHMATQLLAKFEENAPAQSPGIRRQPTQQHERGLSRPSRCPPAQGRPAPVPQWKQGSMK
KEFPQNVGGSDTCYFCQKRVYVMERLSAEGKFFHRSCFKCEHCGTTLRLSAYAYDLEDGK
FYCKPHYCYRLSGYAQRKRPAVAPLSGKEAKGPLQDGPPVDTSGRASSVASSAERTPGSG
VNGLEEPSIAKRLKGTPERIELENYRLSVQRAEELEEVPEETQAEHNLSSVLDKGAEEDV
ASRS
Download sequence
Identical sequences ENSTBEP00000010667 ENSTBEP00000010667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]