SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010985 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010985
Domain Number 1 Region: 1669-1750
Classification Level Classification E-value
Superfamily SMR domain-like 1.96e-21
Family Smr domain 0.00000713
Further Details:      
 
Domain Number 2 Region: 44-93
Classification Level Classification E-value
Superfamily UBA-like 0.0000000102
Family CUE domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010985   Gene: ENSTBEG00000012660   Transcript: ENSTBET00000012682
Sequence length 1750
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_527:778:90803:1 gene:ENSTBEG00000012660 transcript:ENSTBET00000012682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRRKNLGGTPFRKTAAPQKVVVSSVASCEEPSAASVCKMKADQEELFSSVSEMFSDLD
PDVVYLMLSECDFKVDNAMDCLLELSATDTKIEPSAPNAIASENAAGSAIMEERPERESE
DAQVDSFLDMQLTEDLDSLIQNAFEKLNSSPDDQAYSFLPLQDVHSFSDPNELINSNSSS
LAPILSEQNMDLNREPLENSASTLSSNVSPSPSVLNESKCLTKDNLALGCDYPEESLLSS
SSNATNASLVGCVGLGQKHTELLEPERTEAQSSQGPVDLGASEPQAPSNLPGLDSAGTGG
DRGSPAAADVSVPPEGFNFKPHKHPELPPKGKDVSYCPVLTPLPFLLPPPPPPPMWNPLI
PAFDLFQGNHAFVAPVVTTAPHWRPVTYTFPPSAVSHASPTKGWRSKEGTSAYHIQETPV
PHVGRKKTSYVGLVLVLLRGLPGAGKSFLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKEAFEKKISPIIIDNTNLQAWEMKPYVALSQKHKYKVLFREPDTWWK
FKPKELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PRNNEDFPSEKEEKVLSSSSKQLELMEEKTLEVAGENVSPECLPNADLNTGRGEAGAGSH
GLQSALVQEAVHASPSDSESQAQATDKGEQEEPAETASEKECGEAAAQRSVGTVSPGICC
GEDQEDCDPASPVPPPSEKSVPGDMLEERATVKKKAFGKQKSKSTVERFPKHELSNFVGD
WPLDRTIGQRTKRTRKTERASSVHSDKRYGQPQASRALDPGDSASVEEGSSPDSAEAGRQ
AQCHDVPESHRSAKHDTYQDAEKSSLATAGDWPLSESLAQREPRSRWPKTGLHEPSLELG
TRDPGEAVSLHTGPEACWGAAPDNLPVLGGSTLGSAAMLPPDMTHESQTCPSEVSSGQLP
APLTSAGGAAADPGGVRSQTAAAFPEAASTGVPGTEAGVCTQTEPQDFALLWKIERNKMS
ISGSIQVLTGRLDGFKPEAFHINTKSGLQDAIPYRVMHDKCTYVEEAELTSADESENXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
GFTASIFPDAAGDLSGRDEAGPDSQAELPGPESITPSFPGVLKAATPKDVSEMETLVAAE
TGDNLSLSDILNSVSSPSNLELNEEMYFADSSGIKKTKHLSKDDVQVPNTEEYTKEDEQE
MENILMAGGVGEEDKTETPNPTPATMAKSLTIDCLELALPPELAFQLSELFGPVGIDSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSSLIGQIGLNDSEQKS
PQRTGKKLLKTLAAPEMLPLLDHWNTQTKKVSLREIMSEEIALQEKFDLKRETLMFEKDC
ATKLKEKQLFKIFPAINENFLADIFKDHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXAKKSKETEDTASEPFFQDFEYPEYDDYRAEAFLHQQKRMECYSKA
KEAYRMGKKNVATFYARQGSLHEQKMKEANHLAAVEIFEKVNASLLPQSVLDLHGLHVDE
AIEHLITVLQQKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLTSHSFRFSEI
KPGCLKVMLK
Download sequence
Identical sequences ENSTBEP00000010985 ENSTBEP00000010985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]