SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011176 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011176
Domain Number 1 Region: 24-266,306-381
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.38e-55
Family FAD-linked reductases, N-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 361-455
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.73e-17
Family L-aminoacid/polyamine oxidase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011176   Gene: ENSTBEG00000012913   Transcript: ENSTBET00000012896
Sequence length 456
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_130687:44637:58451:-1 gene:ENSTBEG00000012913 transcript:ENSTBET00000012896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSRI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDEERSVGRISFYSKNGV
ACYLTNHGRRIPKDVVEEFSDLYNEVYNLTQEFFRHGKPVNAESQNSVGVFTREEVRNRI
RDDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDDVSLSAFGEWTEIPGAHHIIPSGFL
RVVELLAEGIPAHVIQLGKPVRCIHWDQASARHRGPEIEPREEGNHNHDTGEGGQGREES
RGQRWNEDGQWPVVVECEDCEVIPADHVIVTVSLGVLKRQYTNFFRPGLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESRTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFT
Download sequence
Identical sequences ENSTBEP00000011176 ENSTBEP00000011176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]