SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011285 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011285
Domain Number 1 Region: 88-180
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.06e-24
Family D-aminoacid oxidase-like 0.00000876
Further Details:      
 
Domain Number 2 Region: 20-101,165-183
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000000318
Family D-aminoacid oxidase, N-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011285   Gene: ENSTBEG00000013025   Transcript: ENSTBET00000013027
Sequence length 197
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1328:668:9288:1 gene:ENSTBEG00000013025 transcript:ENSTBET00000013027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPFWKDTVLGFRKLPRELDMFPDFSYGWFNTSLLLEGKRYLQWLTELTERGVQFQRKVES
FEVARGGVDVIINCTGVWAGALQPDPLLQPGRGQIIQVDAPWIKHFIITHDGDQGVYKSP
YIIPGIQTVTLGGIFQLGNWSEVNSVNDHNTIWKGCCRLEPALKDARIVGEWSGFRPTRP
QIRLEREQLRVGPSNTE
Download sequence
Identical sequences ENSTBEP00000011285 ENSTBEP00000011285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]