SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011400 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011400
Domain Number 1 Region: 74-317
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.48e-33
Family Protein-L-isoaspartyl O-methyltransferase 0.004
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000011400
Domain Number - Region: 337-354
Classification Level Classification E-value
Superfamily SOCS box-like 0.0667
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011400   Gene: ENSTBEG00000013172   Transcript: ENSTBET00000013161
Sequence length 357
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4202:77279:150880:-1 gene:ENSTBEG00000013172 transcript:ENSTBET00000013161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYRDNAYKDLAWKHGN
IHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTMVGLILGPFGINHGIELHSDVVEY
AKEKLESFIKNSDSFDKFEFCEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKIL
LKVGGILVMPIEDQLTQIMRTGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAV
RNLQDLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPL
DSEEDEKMEEDNKEEEEKDHSEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK
Download sequence
Identical sequences A0A096MXP2 A0A286XG56 A0A2K5HU65 A0A2K5MBF5 A0A2K6JY00 A0A2K6PTS7 A0A2K6S6D3 G1QIP4
10141.ENSCPOP00000005938 ENSTBEP00000011400 ENSNLEP00000000787 ENSTBEP00000011400 ENSCPOP00000005938 ENSCPOP00000005938 ENSPANP00000004665 XP_003255996.1.23891 XP_006140413.1.99106 XP_006140414.1.99106 XP_006140415.1.99106 XP_010349904.1.74449 XP_010349906.1.74449 XP_010367445.1.97406 XP_011793000.1.43180 XP_011929159.1.92194 XP_011929160.1.92194 XP_013003939.1.53824 XP_014442987.1.99106 XP_017708664.1.44346 ENSNLEP00000000787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]