SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011424 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011424
Domain Number 1 Region: 577-898
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.59e-105
Family PDEase 0.00000264
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000011424
Domain Number - Region: 63-197
Classification Level Classification E-value
Superfamily GAF domain-like 0.00128
Family GAF domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011424   Gene: ENSTBEG00000013141   Transcript: ENSTBET00000013188
Sequence length 929
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5210:58297:121568:-1 gene:ENSTBEG00000013141 transcript:ENSTBET00000013188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSVIDV
VGLQRAVKEALSVVLPRVETVYTYLLDGNSRLVCEDPHHELPQEGKVREAVISGKRLGCN
GLGPSDLPGKPLARLAAPLPPDTQVLVIPLVDKESGAVPAVLVVHCGQLSDREEWSLQAV
EKHTLVALRRVQALQQRGLGAAPGTVQSSAEDQKGATEYTDQDRKILQLCGEHTYDLDAS
SLQLKVLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARN
LSNAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSDDYTKLLHDGIQPVTAIDSNFASFT
YTRSLPEDDTSMAVLSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVS
HFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSV
MERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAE
VGYDRTNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPM
EMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHEVSHSHRGASN
SLDFLDEEYEVPDLNGAGATINGCCLDAE
Download sequence
Identical sequences ENSTBEP00000011424 ENSTBEP00000011424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]