SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011474 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011474
Domain Number 1 Region: 24-82,109-184,227-363
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.94e-48
Family WD40-repeat 0.00086
Further Details:      
 
Domain Number 2 Region: 356-400
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000641
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011474   Gene: ENSTBEG00000013247   Transcript: ENSTBET00000013249
Sequence length 402
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1250:51782:62445:1 gene:ENSTBEG00000013247 transcript:ENSTBET00000013249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLKNFLLHG
TKNDTNSSSLRQNSYSGQKSNPREHIIDCGDIVWSLAFGCLVTVKQSLCVNIEWHPFRFG
QNQLHLATGLNDGRIKIWDVYTGKLLLLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVW
DLKDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFLCMDKYTMIRKLEGHHNDV
VACDFSPDGALLATASYDTRVYVWDPHNGEILMEFGHLFPPPTPIFAGGANDRWVRYVSF
SHDGLHIASIADDKMVRFWRIDEDYPVQVAPLSNGLCWCLSTDGSVLAAGTHDGSVYFWA
TPRQVPSLQHLCRMSIRRVMPTQEVQELPVPSKVLEFLSYRI
Download sequence
Identical sequences ENSTBEP00000011474 ENSTBEP00000011474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]