SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011508 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011508
Domain Number 1 Region: 2-180,207-265,329-337,424-537
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.75e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011508   Gene: ENSTBEG00000013281   Transcript: ENSTBET00000013288
Sequence length 538
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4500:24204:67655:-1 gene:ENSTBEG00000013281 transcript:ENSTBET00000013288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HNGLVAAAYLQRLGVNTVVFERRHVIGGAAVTEEIVPGFKFSRASYLLSLLRPQIYTDLE
LKKHGLRLHLRNPYSFTPMLEEGTGHKGPRSLLLGTDTAENQRQIAQFSRKDAQAFPRYE
EFMGRLALAVDPLLDAAPVDMAAFQHGSLRQKFRSLSTLKPLLKAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVLLHHVMGSLEEIQGAWGYV
QGGMGALSDAIASSATAHGATIFTEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXEWLPEAFVERVSQLDSQSPVTKINVAVDRLPDFLAAPNPPGGQPLPQHQ
CSIHLNCEDTLLLHQAFEDAMGGLPSRRPLIELCIPSSLDPTLAPPGCHVISLFTQYTPY
TLAGGKVWDEQERNAYADKVFDCIEAYAPGFKRSVVGRDILTPPDLERIFGLPGGNIFHC
AMSLDQLYFARPVPLHSGYRCPLPGLYLCGSGAHPGGGVMGAAGRNAAHVVFGDLRNM
Download sequence
Identical sequences ENSTBEP00000011508 ENSTBEP00000011508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]