SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011626 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011626
Domain Number 1 Region: 423-679
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-60
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1325-1581
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-52
Family YWTD domain 0.00000506
Further Details:      
 
Domain Number 3 Region: 791-974
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-41
Family YWTD domain 0.000008
Further Details:      
 
Domain Number 4 Region: 1150-1273
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-25
Family YWTD domain 0.0000618
Further Details:      
 
Domain Number 5 Region: 246-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 6 Region: 336-415,671-718
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000361
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 210-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 50-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 10 Region: 1279-1324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 169-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 8-50
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 980-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000011626
Domain Number - Region: 1581-1618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000745
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011626   Gene: ENSTBEG00000013350   Transcript: ENSTBET00000013425
Sequence length 1874
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2402:33265:221253:-1 gene:ENSTBEG00000013350 transcript:ENSTBET00000013425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDFHC
DNGKCIRRSWVCDGDNDCEDDSDEQDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAVPAPPCNLEEFQC
AYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCDD
QSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFL
CWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQC
TCHTGYRLTEDGHTCQDVNECAEEGYCSQGCTNSEGAFQCWCEAGYELRPDRRSCKALGP
EPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHQRELVFWSDVTLDRILRANLN
GSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLNGAHRKVLLWQNLEKPRA
IALHPMEGTIYWTDWGNTPRIEASSMDGSARRIIADTHLFWPNGLTIDYAGHRMYWVDAK
HHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIR
NKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKISSLACAQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVVVGSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLD
RPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAIDYGSQRLYW
ADAGMKTIEFAGLVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGMDRETLQEN
LENLMDIHVFHRRRPLVSTPCAVENGGCSHLCLRSPNPSGFSCTCPTGINLLPDKTCSPG
MNSFLIFARRIDIRMVSLDIPYFADVVPVNITMKNTIIGVPQEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXFMYWTDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLWADA
HTERIEAADLNGANRHTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILVR
SNLPGLMDIQAVDRAQPLGLNKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDGRTCDP
SPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDVIR
RADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLVNNSL
DEPRAIAVFPRKGLFWTDLGHIAKFERAHLDGSERKVLINTDLGWPNGLTLDYDTRRIYW
VDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKE
TVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARALDFVCACPDEPDGQPCSLV
PGLVPPAPRATSMSEKSPVLPNTPPTTLHSATTRTRASLEEAEGXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKKSKFTDPGMGNLTYSNPSYRT
STQEVKIEAVPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDEAEWDDLKQLRS
SRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDT
GWKHERKLSSESQV
Download sequence
Identical sequences ENSTBEP00000011626 ENSTBEP00000011626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]