SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011736 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011736
Domain Number 1 Region: 76-182
Classification Level Classification E-value
Superfamily WWE domain 4.71e-33
Family WWE domain 0.00000111
Further Details:      
 
Domain Number 2 Region: 36-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000773
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011736   Gene: ENSTBEG00000013563   Transcript: ENSTBET00000013549
Sequence length 360
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3062:169955:180644:1 gene:ENSTBEG00000013563 transcript:ENSTBET00000013549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMAGCGEIDHSINMLPTNRKANESCSNTTPSLTVPECAICLQTCVHPVSLPCKHVFCYLC
VKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDER
TSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAG
LRLDCDANSVNLARESSADGADSISAQSGASVQPLVPSSVRPLTSVDGQLTSPATPSPDA
STSLEDSFAHLQLGGDNIAERSHRGEGEEDHESPSSSRVPAPDTSTEETESDASSDSEDV
SAVVAQRSLTQQRLLVPTANQTVADRSDRSGTDHSVAEGGTVSVSVRSRRPDGQCTVTEV
Download sequence
Identical sequences ENSTBEP00000011736 ENSTBEP00000011736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]