SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011764 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011764
Domain Number 1 Region: 387-443
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000203
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000011764
Domain Number - Region: 113-141
Classification Level Classification E-value
Superfamily WWE domain 0.00126
Family WWE domain 0.009
Further Details:      
 
Domain Number - Region: 49-113
Classification Level Classification E-value
Superfamily WWE domain 0.00157
Family WWE domain 0.0069
Further Details:      
 
Domain Number - Region: 305-369
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0335
Family Hypothetical esterase YJL068C 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011764   Gene: ENSTBEG00000013561   Transcript: ENSTBET00000013581
Sequence length 701
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3496:48722:79093:1 gene:ENSTBEG00000013561 transcript:ENSTBET00000013581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVESQQEPPSQSDPSPSPNSSSSFELLDMDAGSLYEPVSPHWFYCKIIDSRETWIPFN
AQDSRLLEEAYGSGEDCNGRVVPTDGGRYDVHLGERMRYAVYWDELVSEVRRCTWFYKGD
KDNKYIPYSESFSQVLEEAYMLAVTLDEWKKKLESPNREIIVLHNPKLMVHYQPVPGSDE
WGATATEQGRPRTVKRGVENISVDIQCGEPLQIDHLVFVVHGIGPACDLRFRSIVQCXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLQRITLPSINRLRHFT
NDTILDVFFYNSPTYCQTIVDTVASEMNRIYTLFLQRNPDFKGGVSIAGHSLGSLILFDI
LTNQKDPLGNIDSEQGSLTTVMGQGDTPTLEEDLKKLQLSEYLPIFEKERVDKEALALCT
DSDLQAMGIPLGPRKKILDSFRTREEPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF
DPVAYRIEPMVVPGEEIDPMLIPHHKDRKRMHLELREGLSRKSKDLKNNLLGSLRMAWKS
FTRSPYPALTASEAAEAEAPERSEKPSEVSTEETSVADKEEVAPIHVGMLNGGRRIDHVL
QEKPIESFNEYLFALQSHLCYWESEDTVLLVLKEIYQTQGV
Download sequence
Identical sequences ENSTBEP00000011764 ENSTBEP00000011764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]