SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011959 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011959
Domain Number 1 Region: 469-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.66e-34
Family Transglutaminase, two C-terminal domains 0.00000136
Further Details:      
 
Domain Number 2 Region: 368-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.11e-28
Family Transglutaminase core 0.00000224
Further Details:      
 
Domain Number 3 Region: 226-286
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.28e-18
Family Transglutaminase core 0.0000592
Further Details:      
 
Domain Number 4 Region: 3-63
Classification Level Classification E-value
Superfamily E set domains 0.000000000000525
Family Transglutaminase N-terminal domain 0.00042
Further Details:      
 
Domain Number 5 Region: 638-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000144
Family Transglutaminase, two C-terminal domains 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011959   Gene: ENSTBEG00000013793   Transcript: ENSTBET00000013804
Sequence length 687
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5967:76370:111796:-1 gene:ENSTBEG00000013793 transcript:ENSTBET00000013804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDLVLERCDLELEANGQDHHTADLCRERLVVRRGQPFRATLHFEGRNYESSVDKLTFS
AVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNCNDDQGVLLGR
WDNNYGDGVSPMFWIGSVDILQRWKEYGCQRVKYGQCWVFAAVACTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXTYCCGPVPVRAIKEGDLTTKYDAPFVFAEVNADVVDWIRQDDGSMHKSINRSL
VVGLKISTKSVGRDEREDITHTYKYPEGSPEEREAFTRANHLNKLTEKEEKGVAMRIRVG
QSMGVGNDFDVFAHITNDTGEDHACRLLLCARTVSYNGVLGPECGTKDLLDLTLEPFSEK
SIPLRILYEKYRDCLTESNLIKVRGLLIEPATNSYLLAERDLYLENPEIKIRXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDPVEAGEVAKVRVDLMPRHVG
LNKLVVNFESDKLKSVKGYRNVIIGPS
Download sequence
Identical sequences ENSTBEP00000011959 ENSTBEP00000011959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]