SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012314 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012314
Domain Number 1 Region: 431-462,538-583
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000011
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012314   Gene: ENSTBEG00000014198   Transcript: ENSTBET00000014208
Sequence length 583
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1115:126150:161513:-1 gene:ENSTBEG00000014198 transcript:ENSTBET00000014208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAFAMLAAVPPIFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVI
PGGVNATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAA
VHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF
NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYNVDVVGTLSLGXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVLSAIVIVNLKGMFMQFSDL
PFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQXXXXXXXXXXXXXX
XXXXXXXXXXIKEIPGIKIFQINAPIYYANSDLYSNALKRKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXDAEVDGEDGTKPEEGDDEVKYPPIVTKSTFPEELQRFMPPD
LCHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCS
Download sequence
Identical sequences ENSTBEP00000012314 ENSTBEP00000012314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]