SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012351 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012351
Domain Number 1 Region: 705-895,1210-1298,1486-1543
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.73e-101
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000102
Further Details:      
 
Domain Number 2 Region: 158-336
Classification Level Classification E-value
Superfamily EF-hand 7.74e-27
Family Calmodulin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 522-563
Classification Level Classification E-value
Superfamily DUSP-like 0.000000196
Family DUSP, domain in ubiquitin-specific proteases 0.0096
Further Details:      
 
Domain Number 4 Region: 350-395
Classification Level Classification E-value
Superfamily DUSP-like 0.000000248
Family DUSP, domain in ubiquitin-specific proteases 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000012351
Domain Number - Region: 77-145
Classification Level Classification E-value
Superfamily EF-hand 0.00324
Family Calmodulin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012351   Gene: ENSTBEG00000014205   Transcript: ENSTBET00000014254
Sequence length 1581
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_4145:47946:191839:-1 gene:ENSTBEG00000014205 transcript:ENSTBET00000014254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDVELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKVAEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIFSLFSSESGSYVVREEMERMLHVVDGKVPDTLRKCFSEGEK
VNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLE
KRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSAC
CRGPLAERQKFCFKVFDVDRDGVLSRTELRDMVVALLEVWKDNRTDDIPELHTDVSDIVE
DILNAHDTTKIGHLTLEDYQIWSVKNVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRG
WLERESRYGLQPGHNWFIISIQWWQQWKEYVKYXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATSLTLEGGRLKRTPQLIHGKDYE
MVPEPVWRALYHWYGANLALPRPXXXXXXXXXXXXXXXXXXXXXXXQQATRTQQSIWDMX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTC
FMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVA
PLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEV
AAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKPCGHISVRFDPFNFLSLPLPMDSYMHLEI
TVIKLDGSTPVRYGLRLNMDEKYTGLKKQLSDLCGLKSEQILLAEVHGSNIKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDSMGYQYPFTLRVVQKD
GNSCAWCPWYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVDEHESVE
QSRRAQAEPINLDSCLRAFTNEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLK
RFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRDPALCQHKPLTPQGDDLTEPRGLAGEVK
KADAQGSAGEEDMLLSKSPSSLSANIISSPKGSPSSSRKSGTSCPSSKNSSPNSSPRTLG
RSKGRLRLPQIGSKNKLSSSKENLDASKENGVGQICELADALSRGRMLGGSQPELVTPQD
HEVALANGFLYEHEACGNGYSNGHLGNHSEEDSTDDQREDTRIKPIYNLYAISCHSGILG
GGHYVTYAKNPNCKWYCYNDSSCKELHPDEIDTDSAYILFYEQQGIDYAQFLPKIDGKKM
ADTSSMDEDFESDYKKYCVLQ
Download sequence
Identical sequences ENSTBEP00000012351 ENSTBEP00000012351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]