SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012460 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012460
Domain Number 1 Region: 91-321,365-414
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-48
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 
Domain Number 2 Region: 531-673
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-20
Family Glycerol-3-phosphate transporter 0.047
Further Details:      
 
Domain Number 3 Region: 455-514
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000123
Family Pentapeptide repeats 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012460   Gene: ENSTBEG00000014373   Transcript: ENSTBET00000014372
Sequence length 677
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_135232:115066:175241:-1 gene:ENSTBEG00000014373 transcript:ENSTBET00000014372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDYKYQDNYEGYAPNDGYYRGNESNPEEDAQSDVTEGHDEDDEIYEGEYQGIPHPDDIK
AKQTKMAPSRADGQADMMAERMEDEEQLAHQYETIIDECGHGRFQWILFFVLGLALMADG
VEVFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKRVLSMALA
INASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGMFW
MTGGLYASAMAWSIIPHYGWGFSMGTHYHFHSWRVFVIVCALPCTVSLVALKFMPESPRF
LLEMGKHDEAWMILKQVHDTNMRAKGSPEKVFTVSNIKTPKQMDEFIEIQSSTGTWYQRW
LVRFNTTFKQVWDNALYCVMGPYRMNTLILAVVWFSMALSYYGLTVWFPDMIRYFQDEEY
KSRMKVFFGEHLYGATINFTMENQIHQHGKLVNEFTKMYFKHVLFENTFFEDCYFEDVTS
TDTYFKNCTILTSVFYNLYEHKFINCRFINSTFLDQKEGCHMDFEEDNDFLIYLVSFLGS
LSVLPGNIISALLMDRVGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAA
WNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVG
GGLIALRLPETREQVLM
Download sequence
Identical sequences ENSTBEP00000012460 ENSTBEP00000012460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]