SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012581 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012581
Domain Number 1 Region: 3-345
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-132
Family Calpain large subunit, catalytic domain (domain II) 0.00000000203
Further Details:      
 
Domain Number 2 Region: 353-510
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.35e-51
Family Calpain large subunit, middle domain (domain III) 0.00000266
Further Details:      
 
Domain Number 3 Region: 521-606
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000189
Family Penta-EF-hand proteins 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012581   Gene: ENSTBEG00000014486   Transcript: ENSTBET00000014507
Sequence length 699
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2582:4557:48423:1 gene:ENSTBEG00000014486 transcript:ENSTBET00000014507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVSINQSRLQAKGVGQHNNANNYKNQNFEELRAACLRNGKLFEDPLFCAEPSSLGFKEL
GPSSKNMQNICWKRPKEITHNPQFIVDGISPTDICQGILGDCWLLAAIASLTTYPKLLHR
VVPKGQSFKKNYAGIFHFQIWQFGQWVDVVVDDRLPTKNDKLLFVHSSERNEFWGALLEK
AYAKLSGSYEALSGGNTMEGFEDFTGGVSESFQLQKPPQNLRRMLRKAVERSSLMGCSIE
VVSQSDMESMTQKMLVRGHAYSVTGLKDVPYRGRMETLIQVRNPWGRIEWIGAWSDNARE
WEEVTPDIQKQLLSRKEDGEFWMSYQDFLDNFTLLEICNLTPDALAGDSKSYWHTTFYEG
SWRRGSTAGGCRNYLDTFWTNPQFKICLPEEDDPENDAEDNSIVCTCLVALMQKNWRHDR
PQGAQLQTIGFVVYSVFQNIQDIHLKKDFFVKYQDHGFSEIFTNSREVSSQLRLPPGEYI
IIPSTFEPHRDSDFLLRVFTEKHSESWELDNINYAEQLQEETFSENDMDQDFIHLFEIVA
GKDKEVGMYDLQRLLNRMVVKLKHLKTKGFGLDACRCMVNLMDRDGSGKLGLLEFQILWK
KIKKWTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXFFLTKDPENTGHIRLNMEQWLQIIMWG
Download sequence
Identical sequences ENSTBEP00000012581 ENSTBEP00000012581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]