SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012615 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012615
Domain Number 1 Region: 532-560,603-682
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-16
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012615   Gene: ENSTBEG00000014543   Transcript: ENSTBET00000014545
Sequence length 696
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2075:93388:96259:-1 gene:ENSTBEG00000014543 transcript:ENSTBET00000014545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISHEALQQDGELVLVRRQPPEPQGLREMLKTRLRQNCSCSLPCAWALVQALFPAIHWL
PRYRLREYLVGDXXXXXXXXXXXXXXXXXYSLLWLPISLYTSFLHIIYLMGTSHVSVGIF
SLLCLMVGQVVDRELQEAGFDPSQDGPGPWANSSALNNSAMTLVLGPQDCGRDCHAIRVA
TALTLMTGIYQVLMGILRLGFVSAYLSQSLLDGFAMGASVTILTSQLRHLLGVRVPRHQG
PGMVVSTWLSLLRNAGQANVCDVVTSTVCLVVLLASKELSDRYRHRLRVPLPTELLVIVV
ATVVSHFGQLHERFGSSVAGNIPTGFEAPEVPDPKLMQRVALDAVPLALVGSAFSISLAE
MFARNHGYSVRANQELLAVGCCNVLPAFFHCFATSAALAKSLVKIATGCRTQLSSVVSAT
VVLLVLLVLAPLFRDLQRSVLACVIVVSLRGALRKVRDLPQLWRLSRTDALVWVATAATC
VLVSTEAGLLAGVLLSLLSLAGRTQHPHAALLARIGDSAFYEDTTEFEGLTPEPGVQVFR
FTGPLCYTNKDFFLRSLYSLTGLDVGRWAARRKERGSEVGVSESDPIDNKDSGPVSSRAA
LVAGATGFHTVIIDCAPMLFLDAAGMSMLQDLRRDYEALGIALLLACCSPSVRDTLRKGS
FLREDQEEQQLFHSVHSAVQAARVRRRELAAADSTL
Download sequence
Identical sequences ENSTBEP00000012615 ENSTBEP00000012615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]