SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012794 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012794
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-27
Family Galectin (animal S-lectin) 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012794   Gene: ENSTBEG00000014756   Transcript: ENSTBET00000014745
Sequence length 96
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5722:679:2562:-1 gene:ENSTBEG00000014756 transcript:ENSTBET00000014745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVPHKTLLPEGIRPGTVLKIQGVVPEKANRFHVNLLCSEGEDADAALHFNPRLDTAEVVF
NSKQRGSWGAEERGSSVPFHRGPFEVLLITTDEGFK
Download sequence
Identical sequences ENSTBEP00000012794 ENSTBEP00000012794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]