SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012816 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012816
Domain Number 1 Region: 38-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 9e-58
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 345-389
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000314
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012816   Gene: ENSTBEG00000014778   Transcript: ENSTBET00000014769
Sequence length 396
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3083:13038:24316:-1 gene:ENSTBEG00000014778 transcript:ENSTBET00000014769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRNSPPHWGFPSSSTADLLLKRAAEPRLSSHQRGLWSLTYEEELTTPLHVAASRGHTDI
LRLLLRRRARPDCAPGGRTALHEACAAGHPACVHVLLVAGADPNIPDQDGKRPLHLCRGA
GTLECAELLLRFGAKADGRSEEEEETPLHVAARLGHVELAELLLRRGACPDARDAEGWTP
LLAACDTRCQSPADAEATTARCLQLCRLLLSAGADPDAADGDKRRPLHLACRRGHVAVVE
LLLSCGVSTNAMDYGGHTALHCALQGPAAALAQSPEHAVRALLNHGAVRVWPGALPKVLE
RWCTCPRTIEVLMNTYTVVQLPEEAVGLIPPETLQKHQRFYSSLFALVRQPRSLQHLSRC
ALRAHLEGYLPHALPRLPLPPRLLRYLQLDFEDVLY
Download sequence
Identical sequences ENSTBEP00000012816 ENSTBEP00000012816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]