SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013423 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013423
Domain Number 1 Region: 521-552,656-731
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000424
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013423   Gene: ENSTBEG00000015428   Transcript: ENSTBET00000015470
Sequence length 878
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1644:180501:234624:-1 gene:ENSTBEG00000015428 transcript:ENSTBET00000015470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLS
WLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSFFLPPLTYFFGGVH
QVTGTFAVISILVGNICLQLAPESKFRVFNSTTNESYVDTAAMEAERLHVSATLACLTAI
IQMGLGFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTVPSYTGPGSIVFTFI
DICKNLPHTNIASLVFALISGVFLVLVKELNARYRHKIRFPIPTEMIVVVVATAISGGCK
MPKKYHMQIVGEIQHGFPTPVLPVVSQWKDMIGTAFSLAIVGYVINLAVGRTLANKHGYD
VDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITMLVL
GTYLYPLPKSVLGALIAVNLKNSLKQLADPYYLWRKSKLDCXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRNGYALAQVVDTDLYVNPKTYSQAQEIEGVKIVTYCSPIYFAN
SEIFRQKVIAKTGLDPQKVLLAKQKCLRKQEKRRAMPTQQRKSLFMKTKTVSLQELQQDF
ENASPTDPNNNQTPANGASVSYITLSPDTSPAAQREPPASAEHPAEPSDMLASVPPFITY
HTLILDMGGVSFVDXXXXXXXXXLSSTYGKIGVKVFLVNVHAQVYNDISHGGVFEDGCLE
RSHVFPSIHDAVLFACATAREVARGHSLQRAPGDPEVSLSDSEDDSPGYWDLEQEVFGSM
FHTETLTALKSLSAPECSYRGGSLASPLLTPALATRSKLPTLSTLPTALPVAAKGHLDLQ
MVRQEQKDKSADMVCKLQKTSQGLHGLVPDGAGLSQTQ
Download sequence
Identical sequences ENSTBEP00000013423 ENSTBEP00000013423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]