SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013802 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013802
Domain Number 1 Region: 8-337
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.66e-84
Family Calpain large subunit, catalytic domain (domain II) 0.00000261
Further Details:      
 
Domain Number 2 Region: 508-658
Classification Level Classification E-value
Superfamily EF-hand 5.36e-23
Family Penta-EF-hand proteins 0.00021
Further Details:      
 
Domain Number 3 Region: 344-473
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.19e-18
Family Calpain large subunit, middle domain (domain III) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013802   Gene: ENSTBEG00000015867   Transcript: ENSTBET00000015894
Sequence length 660
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1746:611496:670741:-1 gene:ENSTBEG00000015867 transcript:ENSTBET00000015894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHNQESLAQTSVTKFKDQDFNSLRDRCLSRGRLFKDETFPAMDSSIGQKLLQGKNLTSL
EWKRPQELSVVPPHFILEGASRFDIQQGTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXFWQCGQWVEVVVDDRLPVMGNVCLFVGPRKDNQEFWPCLLEKAYAKLLGSY
SHLHYYLPDALVDLTGGVVTSVNLHSLPSELVMAVKIAAKTGSLMTCATPKGPMDGAQTM
ENGLVCQHAYTVTAAEQIQYKRGWEEIIRLWNPWGNTEWRGRWRDGSREWQETQDQRKNQ
LYEDKEDGEFWMSCQDFQENFSCLFICNQIPITLDHGNPLHERWSQMMFKNQVIRGNTAG
QSQREAQYFFFVPKQTEGINVVVSFTIMPQSWKSEDEIFPLSFQVFKQFGERLPPEFFSP
FRNAAQGLDHETKRNFTKSLHLSPGTYVVVPSARREEAEFFLRIFLKVPDSSRNLNSNFN
LRALKXXXXXXXXXXXXXXXXXXXGLDIDATQLQSLLNQEFLTGPPGDTFSLDECRSIVA
LMDLKVNGRLDHEEFARLWMRLVHCQHVFQSIQHSGVLLSSDLQKAIENTDFLSGIFISS
ELLGLMMLRYSDNTGRVSFPSLVCFLIRLEAMAKTFRNLSMDGKGLYLTEMEWMNLVMYN
Download sequence
Identical sequences ENSTBEP00000013802 ENSTBEP00000013802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]