SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013904 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013904
Domain Number 1 Region: 28-236,297-354
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.41e-27
Family D-aminoacid oxidase, N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 223-309
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.7e-20
Family D-aminoacid oxidase-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013904   Gene: ENSTBEG00000016007   Transcript: ENSTBET00000016009
Sequence length 368
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_246:146845:166431:-1 gene:ENSTBEG00000016007 transcript:ENSTBET00000016009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRPTSHWKTSFNGVCWGFQGGFSGDRLMNTARIAVVGAGVMGLSTAVCISKLVPGCSITI
IAEKRTPDTTSDVAAGVLIPHAFPDTPIPKQKQWFKETFDHLFAIANSAEAGDAGVQLVS
GWQIFQSIPAEEVPFWADVVLGFRKMTEAELKKFPHHGFGQAFTTLKCESSAYLPWLENR
VKGNGGLILTRRVEDLWELHPSFDIVVNCSGLGSRQLMGDSKIFPVRGQVLKVQAPWVKH
FIREGSGLTYIYPGAYDVTLGGTRQKGDWNLSPDAKISRDILSRCCALEPSLHRACSIKE
KVGLRPSRPGMRLQKELLVQDGRRLPVVHHYGHGSGGISVHWGTALEAARLVRECVLALK
TSAPKSKL
Download sequence
Identical sequences ENSTBEP00000013904 ENSTBEP00000013904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]