SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014046 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014046
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily E set domains 4.55e-50
Family Transglutaminase N-terminal domain 0.000000146
Further Details:      
 
Domain Number 2 Region: 148-325
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.38e-45
Family Transglutaminase core 0.000000193
Further Details:      
 
Domain Number 3 Region: 474-583
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.68e-32
Family Transglutaminase, two C-terminal domains 0.00000192
Further Details:      
 
Domain Number 4 Region: 586-683
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.93e-27
Family Transglutaminase, two C-terminal domains 0.00000425
Further Details:      
 
Domain Number 5 Region: 363-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.11e-25
Family Transglutaminase core 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014046   Gene: ENSTBEG00000016164   Transcript: ENSTBET00000016167
Sequence length 688
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1959:26893:237053:-1 gene:ENSTBEG00000016164 transcript:ENSTBET00000016167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLNVTAVHLFKERWDTNKVEHHTDRYDNDKLIVRRGKTYYIQIDFNRPYDPRKDFFRVEY
VIGRYPQENKGTYIPVPVVSELKSGKWGAKVIMTEDKSVRLSIQSSPECIVGKFRMYIAV
WTPYGIIRTSRNPETDTYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFYGDANDIKTR
SWSYGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINAKDDDGVLVGSWDNIY
AYGVPPSAWTGSVDILLEYQSSENPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHD
NDANLQMDIFLEEDGNVNSKLTKDSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXMYRCGPASVQAIKHGHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVEAVDATHIGKL
IVTKQIGGDGMMDITDTYKFQEGQEEERLALETALMYGAKKPLHTDDVTKPRSNIDMDFE
VETAVLGKDFKLTITFRNNSSNRYTITAYLSGNITFYTGVSKEEFKKETFDLTLEPLAFK
KEEVLIRASEYMGQLLEQASLHFFVTARVNETKDILAKQKSSVLVIPKVILKVRGAQIVG
SDMVVTVEFTNPLKETLQNVWLYLEGPGVIRSKRKMFNEIRPNSTVQWEELCRPWVPGPR
KLIASMSSDSLRHVYGELDLQIQRRPSM
Download sequence
Identical sequences ENSTBEP00000014046 ENSTBEP00000014046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]